PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ZH4X8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 487aa    MW: 55357.6 Da    PI: 5.4924
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ZH4X8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS168.17.1e-52260485143374
         GRAS 143 RiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                  R+T++g  +  +k+++e tg+rL++fAe+l++pf+++++++++l++++l++++v+ +E +aV +++ l +l++++ +le+    ++ ++++++P +++
  Aradu.ZH4X8 260 RVTAIGTCA--EKKKIEGTGQRLTSFAESLNLPFSYKAIIVTDLAEIKLDDFDVDDDEGVAVYSAYFLRTLVSRPNCLEN----LMLVIRNIKPSIMI 351
                  99*****55..9************************************************************99998888....999*********** PP

         GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                  v e +++hns+sF++rf++al y+sa++d+le+ l ++se r+ vE++  +  i+n+va+eg+er+ r+ +l  Wr+ + +  + +  +se+   qa+
  Aradu.ZH4X8 352 VLEIDSNHNSPSFVNRFIDALFYFSAFMDCLETCLKEDSECRMAVEAV-CAAGIRNIVAAEGKERTVRNVKLDVWRRFFARYKMVETGFSESSLYQAN 448
                  ***********************************************9.6789********************************************* PP

         GRAS 339 lllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  l+ +++  ++  +v+++ +sl+  Wk+ p+ s+SaW+
  Aradu.ZH4X8 449 LVAKEFTfGKFCSVDKNGKSLIVSWKGAPMHSLSAWK 485
                  *******777789999999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.211229464IPR005202Transcription factor GRAS
PfamPF035142.4E-49260485IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MGIGPLSSTP FNFSGFQGGY DSVNIHEEKF VLQEKQGFSA VMELGRGDNL FKHQQHHQRK  60
HDHDDEDIKV GDMILQDVIN FDPDYDSLQP TSQEFQETIE FKNIHQAPSS LTIASLELLR  120
NYGSKFKKLT GENISDNFSS DNIENSTCSE NQRLSTEEIM RVAGARYVHY SAHWNDDFCI  180
PMHPYGLDVR NLSEEENRDV ELAQFLLAAA ERVGCRQFER ASRLLLHCQW NSDVIANAAQ  240
RVIFHFAEAL RQRINKETGR VTAIGTCAEK KKIEGTGQRL TSFAESLNLP FSYKAIIVTD  300
LAEIKLDDFD VDDDEGVAVY SAYFLRTLVS RPNCLENLML VIRNIKPSIM IVLEIDSNHN  360
SPSFVNRFID ALFYFSAFMD CLETCLKEDS ECRMAVEAVC AAGIRNIVAA EGKERTVRNV  420
KLDVWRRFFA RYKMVETGFS ESSLYQANLV AKEFTFGKFC SVDKNGKSLI VSWKGAPMHS  480
LSAWKFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207558.11e-179PREDICTED: DELLA protein RGL1-like
TrEMBLK7MZL11e-119K7MZL1_SOYBN; Uncharacterized protein
TrEMBLK7MZL21e-120K7MZL2_SOYBN; Uncharacterized protein
STRINGGLYMA19G40440.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-31GRAS family protein